Quantity
Price
$48.00
Out of stock
VIP
From $48.00to $375.00
For laboratory research use only. Not for human or animal use, consumption, diagnosis, treatment, or disease prevention.
This item is available only through approved account access.
Product Specifications
- Lot Number
- —
- Purity
- —
- Storage Temp
- 36°F to 46°F
For Research Use Only. Not for human or animal administration. Not intended to diagnose, treat, cure, or prevent any disease. Sold for laboratory research purposes only.
Documentation
Certificates of Analysis are supplied with each product lot where applicable.
Certificate of Analysis (COA)
Documentation will be available once product lots are received and tested.
All products currently listed on this site are for research purposes only.
COA Library
Published Certificates of Analysis for VIP. New deliveries are added as their batches are released.
No released COA for this strength yet
Reports appear here once a batch for this strength has been released.
Research Data
Chemical & Structural Identifiers
- Chemical Name (IUPAC)
- L-histidyl-L-seryl-L-α-aspartyl-L-alanyl-L-valyl-L-phenylalanyl-L-threonyl-L-α-aspartyl-L-asparaginyl-L-tyrosyl-L-threonyl-L-arginyl-L-leucyl-L-arginyl-L-lysyl-L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-asparaginyl-L-seryl-L-isoleucyl-L-leucyl-L-asparaginamide
- CAS Registry Number
- 37221-79-7
- Molecular Formula
- C₁₄₇H₂₃₈N₄₄O₄₂S
- Molecular Weight
- 3326.8 g/mol (monoisotopic)
- Sequence
- H-His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH₂ (single-letter: HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH₂)
- Salt / Counter-Ion
- Supplied as a high-purity lyophilized acetate (CH₃COO⁻) or trifluoroacetate (CF₃COO⁻) salt.
- Synonyms
- VIP, Vasoactive intestinal peptide, VIP (human), Vasoactive intestinal polypeptide
Analytical & COA Specifications
- Analytical Purity (RP-HPLC)
- ≥ 98.0% area normalization under UV detection at λ = 214 nm and 280 nm (aromatic chromophore detection).
- Identity Confirmation (ESI-MS / MALDI-TOF)
- Theoretical monoisotopic mass [M+H]⁺ = 3327.8 Da; observed mass-to-charge ratio m/z = 3327.8 ± 0.5 Da.
- Residual Moisture (Karl Fischer Titration)
- ≤ 2.0% water content.
- Endotoxin Screening (LAL Assay)
- < 1.0 EU/mg (Limulus Amebocyte Lysate per USP <85>).
- Sterility Validation
- USP <71> compliant (no observed microbial proliferation).
- Physical Characterization
- Dense, white to off-white lyophilized solid cake/powder.
Handling & Stability
Storage. Store dry solid desiccated at −20°C to −80°C, protected from atmospheric moisture and direct light.
Solubility. Soluble in sterile laboratory-grade deionized water (≥ 1 mg/mL) and sterile Phosphate-Buffered Saline (PBS, pH 7.4) for in vitro assay application.
- Handling & Aliquoting: Protect the methionine residue from oxidation during handling; prepare concentrated stock solutions freshly or aliquot into single-use fractions at −20°C to eliminate degradation from repeated freeze-thaw cycles.
Mechanism & Literature
Structural Origin & Classification: 28-amino-acid endogenous neuropeptide of the glucagon/secretin superfamily, characterized by a C-terminal amide and an N-terminal histidine residue.
Receptor Signaling Investigated: Documented in vitro and in preclinical models as a ligand for the class B G-protein-coupled receptors VPAC1 and VPAC2, activating adenylate cyclase and the cAMP/protein kinase A pathway.
Cellular Effects Characterized: Evaluated in cell culture models for modulation of inflammatory cytokine signaling, vasodilatory mediator release, and neurotrophic factor expression in neuronal and immune cell systems.
Technical Laboratory FAQs
What is the sequence and structural classification of VIP?
Vasoactive intestinal peptide (VIP) is a 28-amino-acid neuropeptide with the C-terminally amidated sequence HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH₂ and a monoisotopic molecular mass of 3326.8 Da, classified within the glucagon/secretin peptide superfamily.
How is VIP evaluated in receptor-signaling and immunomodulatory assays in vitro?
Preclinical literature examines VIP for VPAC1/VPAC2 receptor binding, cAMP/PKA pathway activation, and modulation of inflammatory and neurotrophic signaling markers in cultured neuronal and immune cell models.
What solvent matrix is recommended for preparing in vitro VIP stock solutions?
Sterile deionized water or sterile PBS (pH 7.4) provides dissolution for cell culture and biochemical assays; protect from oxidation and avoid repeated freeze-thaw cycles by aliquoting.
For Research Use Only. Not for human or animal administration. Not intended to diagnose, treat, cure, or prevent any disease. Sold for laboratory research purposes only.